PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0868s00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 234aa    MW: 26421.2 Da    PI: 3.9671
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0868s00060.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.92e-073564130
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                      +g+WT+eEd++l++ +   G  +W+++++ 
  Vang0868s00060.1 35 KGPWTAEEDKKLINFILTNGQCCWRAVPKL 64
                      79*************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-92664IPR009057Homeodomain-like
SuperFamilySSF466891.48E-62964IPR009057Homeodomain-like
PROSITE profilePS500906.263063IPR017877Myb-like domain
PfamPF002495.0E-63564IPR001005SANT/Myb domain
CDDcd001670.003383763No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
LRDQLQIPGT LSWHLSCVEH KMGRQPCCDK VGLKKGPWTA EEDKKLINFI LTNGQCCWRA  60
VPKLAVEEDP KFEPENGQNK EPEKAETSFD VSTITEEAKE EDQIMIPLFE SIMNELFTDE  120
VPIIEPSEIL VPSATSTSPT TTSSSTSSSS YSNSPNFFED LQLPDFDWSD DYNDTKIDNN  180
NSSVALWDDD LIRSWNMLIN DDGDGDRKQV FDTSANQYPR LIMDSESWAY GLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014495432.18e-92PREDICTED: protein ODORANT1
TrEMBLA0A0L9U9366e-96A0A0L9U936_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RZU36e-96A0A0S3RZU3_PHAAN; Uncharacterized protein
STRINGGLYMA11G33620.11e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-26myb domain protein 20